DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and PSD2

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_011535998.1 Gene:PSD2 / 84249 HGNCID:19092 Length:791 Species:Homo sapiens


Alignment Length:406 Identity:102/406 - (25%)
Similarity:169/406 - (41%) Gaps:91/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 QSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKP-QKG 600
            |.|...|.|..:.|.:.::|.|..||   ::.|.|....|...:        |:|..:..| ..|
Human   273 QGPGGDEDDDEEDTDKLLNSASDPSL---KDGLSDSDSELSSSE--------GLEPGSADPLANG 326

  Fly   601 VQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAAL 665
            .|.:.|      ....:||.|:..|...:..:...:|:|::.|:.|...|:..|||..:.:..||
Human   327 CQGVSE------AAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDGAL 385

  Fly   666 RFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHSPQVKHK 730
            |..|:.|.|.||.|:.:|::..|:.|||:|||.:.  .|.|.::.|..::::|.||||...:..|
Human   386 RTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDS--TSEDGIHTLTCALMLLNTDLHGHNIGKK 448

  Fly   731 MTKEQYI----KMNRGISDSKSDLPEEYLSSIYDE-----ISEHEIKMKNNSGMLQQAKPTGKQA 786
            |:.:|:|    ::|.| .|...||.:...:||.:|     |.|.|:: |:.|.::.....||   
Human   449 MSCQQFIANLDQLNDG-QDFAKDLLKTLYNSIKNEKLEWAIDEDELR-KSLSELVDDKFGTG--- 508

  Fly   787 FITEKRRKLL--WNMEMEV-ISLTATNLMQSVSHVKSPFTSAKHLE---HVRPMFKMAWTPFLAA 845
              |:|..::|  .|..::| .:|:||.....|      .|...|.:   ...|..:..|..|.|.
Human   509 --TKKVTRILDGGNPFLDVPQALSATTYKHGV------LTRKTHADMDGKRTPRGRRGWKKFYAV 565

  Fly   846 FSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAY--VQALARFTLLNA----------- 897
            ..           .|:                :.|::|.|  .:||:...|.||           
Human   566 LK-----------GTI----------------LYLQKDEYRPDKALSEGDLKNAIRVHHALATRA 603

  Fly   898 ---NSPINEMKAKNID 910
               :...|.:|.|..|
Human   604 SDYSKKSNVLKLKTAD 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 102/406 (25%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 57/194 (29%)
DUF1981 1080..1161 CDD:286414
PSD2XP_011535998.1 Sec7 317..484 CDD:238100 53/175 (30%)
PH_EFA6 530..653 CDD:270107 22/123 (18%)
PH 550..645 CDD:278594 17/97 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.