DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and Psd2

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_036017188.1 Gene:Psd2 / 74002 MGIID:1921252 Length:771 Species:Mus musculus


Alignment Length:401 Identity:100/401 - (24%)
Similarity:167/401 - (41%) Gaps:93/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 EQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKP-QKGVQFLQE 606
            ::|..||. :.::|.|..||   ::.|.|....|...:        |:|..:..| ..|.|.:.|
Mouse   257 DEDDEDTD-KLLNSASDTSL---KDGLSDSDSELSSSE--------GLEPGSTDPLANGCQGVSE 309

  Fly   607 KQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEG 671
                  ....:||.|:..|...:..:...:|:|::.|:.|...|:..|||..:.:..|||..|:.
Mouse   310 ------AARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKA 368

  Fly   672 FRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHS-PQVKHKMTKEQ 735
            |.|.||.|:.:|::..|:.|||:|||.:.  .|.|.::.|..::::|.||||. ..:..||:.:|
Mouse   369 FPLMGETQERERVLTHFSRRYCQCNPDDS--TSEDGIHTLTCALMLLNTDLHGHVNIGKKMSCQQ 431

  Fly   736 YI----KMNRGISDSKSDLPEEYLSSIYDE-----ISEHEIKMKNNSGMLQQAKPTGKQAFITEK 791
            :|    ::|.| .|...||.:...:||.:|     |.|.|:: |:.|.::.....||     |:|
Mouse   432 FIANLDQLNDG-QDFAKDLLKTLYNSIKNEKLEWAIDEDELR-KSLSELVDDKFGTG-----TKK 489

  Fly   792 RRKLL--WNMEMEV-ISLTATNLMQSVSHVKSPFTSAKHLE---HVRPMFKMAWTPFLAAFSVGL 850
            ..::|  .|..::| .:|.||.....|      .|...|.:   ...|..:..|..|.|...   
Mouse   490 VTRILDGGNPFLDVPQALNATTYKHGV------LTRKTHADMDGKRTPRGRRGWKKFYAVLK--- 545

  Fly   851 QDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAY--VQALARFTLLNA--------------NS 899
                    .|:                :.|::|.|  .:||:...|.||              :.
Mouse   546 --------GTI----------------LYLQKDEYRLDKALSEGDLKNAIRVHHALATRASDYSK 586

  Fly   900 PINEMKAKNID 910
            ..|.:|.|..|
Mouse   587 KSNVLKLKTAD 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 100/401 (25%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 57/195 (29%)
DUF1981 1080..1161 CDD:286414
Psd2XP_036017188.1 Sec7 294..462 CDD:238100 53/176 (30%)
PH_EFA6 508..631 CDD:270107 22/123 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.