DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and PSD

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_001257894.1 Gene:PSD / 5662 HGNCID:9507 Length:1024 Species:Homo sapiens


Alignment Length:374 Identity:86/374 - (22%)
Similarity:143/374 - (38%) Gaps:127/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 SKIAQGRQ---------ALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPPM- 534
            :|:|.||:         :|.|||.|:        |.|                        ||: 
Human   491 AKLAPGREPPSPCHSEDSLGLGAAPL--------GSE------------------------PPLS 523

  Fly   535 QVQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKPQK 599
            |:.|.:.:|.|    :.:.:..||:.:|::.|:...:..:.|.:|..|                 
Human   524 QLVSDSDSELD----STERLALGSTDTLSNGQKADLEAAQRLAKRLYR----------------- 567

  Fly   600 GVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAA 664
                     |.|....|:||               ::|:|:|.||.|...|:..|.|..|.:..|
Human   568 ---------LDGFRKADVAR---------------HLGKNNDFSKLVAGEYLKFFVFTGMTLDQA 608

  Fly   665 LRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHSPQVKH 729
            ||..|:...|.||.|:.:|::..|:.||.:|||  :...|.|..:.|..::::|.||||...:..
Human   609 LRVFLKELALMGETQERERVLAHFSQRYFQCNP--EALSSEDGAHTLTCALMLLNTDLHGHNIGK 671

  Fly   730 KMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSGMLQQAKPTGKQAFITEKRRK 794
            :||...:|....|::|. .|.|.|.|.::|..|                            |..|
Human   672 RMTCGDFIGNLEGLNDG-GDFPRELLKALYSSI----------------------------KNEK 707

  Fly   795 LLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKMAWTPFL 843
            |.|.::.|       .|.:|:|.:..|  :.|.::.:........:|||
Human   708 LQWAIDEE-------ELRRSLSELADP--NPKVIKRISGGSGSGSSPFL 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 86/374 (23%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 50/184 (27%)
DUF1981 1080..1161 CDD:286414
PSDNP_001257894.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..536 17/80 (21%)
Sec7 542..708 CDD:238100 57/237 (24%)
PH_EFA6 753..877 CDD:270107
PH 757..865 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 976..1024
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.