DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and cyth1b

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_005169523.1 Gene:cyth1b / 325586 ZFINID:ZDB-GENE-030131-4311 Length:416 Species:Danio rerio


Alignment Length:263 Identity:107/263 - (40%)
Similarity:152/263 - (57%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 PVPPMQVQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEE---------------- 578
            |.||......|..|:.:.:           :.....||.|:|:....:|                
Zfish    22 PAPPAVPDDLTPEEKQELE-----------NIRRRKQELLEDIQRLKDEITKVTNEIECLGSTQE 75

  Fly   579 --RKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDD 641
              ...|.:.|..|.:.||..|:||:|||.|.:||..||.|||::|::.|.|:||.||:|:||.|:
Zfish    76 RINMQRSKQMAMGRKKFNMDPKKGIQFLIENELLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDE 140

  Fly   642 HSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSAD 706
            .:.:|:.|:::..:|..:.:|.|||..|..||||||||||||:||.||.|||:|||  .:|||.|
Zfish   141 FNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNP--GVFQSTD 203

  Fly   707 TVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKN 771
            |.|||:|:||||.|.||:|.||.|.:.|::|.|||||:|. .||||:.|.::|:.|.....|:..
Zfish   204 TCYVLSFAIIMLNTSLHNPNVKDKPSAERFICMNRGINDG-GDLPEDLLRNLYESIKNEPFKIPE 267

  Fly   772 NSG 774
            :.|
Zfish   268 DDG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 107/263 (41%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 95/184 (52%)
DUF1981 1080..1161 CDD:286414
cyth1bXP_005169523.1 GPS2_interact 18..90 CDD:292412 13/78 (17%)
Sec7 81..263 CDD:279680 95/184 (52%)
PH_GRP1-like 278..397 CDD:269954
PH 282..395 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.