DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and CYTH4

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_037517.1 Gene:CYTH4 / 27128 HGNCID:9505 Length:394 Species:Homo sapiens


Alignment Length:206 Identity:96/206 - (46%)
Similarity:135/206 - (65%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 DLPEALEERKMRKEVME--TGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIG 633
            |..|:.||.:|.::..|  .|.:.||..|.||:|:..|.:||.....||||:|::.|.|:||.||
Human    48 DCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIG 112

  Fly   634 NYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPK 698
            .|:||.|..:.:|:.|::|..:|..:.:|.|||..|..||||||||||||:||.||:|||.||| 
Human   113 TYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNP- 176

  Fly   699 NQLFQSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEIS 763
             .:|||.||.|||:||||||.|.||:|.|:.:...|:::.|||||::. |||||:.|.:::|.|.
Human   177 -GVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNG-SDLPEDQLRNLFDSIK 239

  Fly   764 EHEIKMKNNSG 774
            .....:..:.|
Human   240 SEPFSIPEDDG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 96/206 (47%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 90/186 (48%)
DUF1981 1080..1161 CDD:286414
CYTH4NP_037517.1 Sec7 61..243 CDD:279680 90/184 (49%)
PH_GRP1-like 258..376 CDD:269954
PH 262..374 CDD:278594
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 268..275
C-terminal autoinhibitory region. /evidence=ECO:0000250 386..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.