Sequence 1: | NP_609675.2 | Gene: | Sec71 / 34785 | FlyBaseID: | FBgn0028538 | Length: | 1653 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037517.1 | Gene: | CYTH4 / 27128 | HGNCID: | 9505 | Length: | 394 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 96/206 - (46%) |
---|---|---|---|
Similarity: | 135/206 - (65%) | Gaps: | 5/206 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 571 DLPEALEERKMRKEVME--TGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIG 633
Fly 634 NYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPK 698
Fly 699 NQLFQSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEIS 763
Fly 764 EHEIKMKNNSG 774 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sec71 | NP_609675.2 | PLN03076 | 13..1580 | CDD:215560 | 96/206 (47%) |
DCB | 30..212 | CDD:292830 | |||
Sec7_N | 312..465 | CDD:289549 | |||
Sec7 | 582..767 | CDD:279680 | 90/186 (48%) | ||
DUF1981 | 1080..1161 | CDD:286414 | |||
CYTH4 | NP_037517.1 | Sec7 | 61..243 | CDD:279680 | 90/184 (49%) |
PH_GRP1-like | 258..376 | CDD:269954 | |||
PH | 262..374 | CDD:278594 | |||
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 | 268..275 | ||||
C-terminal autoinhibitory region. /evidence=ECO:0000250 | 386..394 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5307 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |