DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and FBXO8

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_036312.2 Gene:FBXO8 / 26269 HGNCID:13587 Length:319 Species:Homo sapiens


Alignment Length:193 Identity:57/193 - (29%)
Similarity:101/193 - (52%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 PEALEERKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIG 637
            |.....||:..: ::.|...||..|.:||.:...|.:|..:..:||:::.....|:...:..|: 
Human   127 PLGFSFRKLYMQ-LDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYL- 189

  Fly   638 ENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGE-AQKIDRLMEKFASRYCECNP--KN 699
               |..::|:...:...:||...:..|||........|.| .:.::.|:.||:.|:|.|||  ..
Human   190 ---DERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMR 251

  Fly   700 QLFQSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEI 762
            :|..|.|.||||.:|:|:|:.||.||.||:||:|.::|:..|   .:..::.|:::..:||.|
Human   252 ELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTR---RAAQNISEDFVGHLYDNI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 57/193 (30%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 54/184 (29%)
DUF1981 1080..1161 CDD:286414
FBXO8NP_036312.2 F-box-like 74..112 CDD:372399
Sec7 133..312 CDD:238100 56/187 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.