DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and Iqsec2

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_006528905.1 Gene:Iqsec2 / 245666 MGIID:3528396 Length:1520 Species:Mus musculus


Alignment Length:252 Identity:85/252 - (33%)
Similarity:142/252 - (56%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 QTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGD 616
            :|.||..|.:.|:         :.::.|..|     .|:.|||:||:||:|:|.|:..|..|...
Mouse   769 ETRHSWDSPAFNN---------DVVQRRHYR-----IGLNLFNKKPEKGIQYLIERGFLSDTPVG 819

  Fly   617 IARWLHEDERLDKTVIGNYIGEND-DHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQK 680
            :|.::.|.:.|.:.:||.::|... ..:::|:...:|..||..|::..|||......|:.|||||
Mouse   820 VAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQK 884

  Fly   681 IDRLMEKFASRYCECNPK-NQLFQSADTVYVLAFSIIMLTTDLHSPQVK--HKMTKEQYIKMNRG 742
            ::||:|.|:.|||.|||. .:.|::.||:::|||:||:|.||::||.||  .||..:.:||..||
Mouse   885 VERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRG 949

  Fly   743 ISDSKSDLPEEYLSSIYDEISEHEIKMKNNSGMLQQAKP---TGKQAFITEKRRKLL 796
            : |:..|:|.:.|..||..|...|::..::.....||..   .||:..::...|:|:
Mouse   950 V-DNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLV 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 85/252 (34%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 72/188 (38%)
DUF1981 1080..1161 CDD:286414
Iqsec2XP_006528905.1 ATG16 <23..>64 CDD:370001
Sec7 785..973 CDD:366596 73/193 (38%)
IQ_SEC7_PH 993..1125 CDD:374551 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.