DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and Psd3

DIOPT Version :10

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_036009810.1 Gene:Psd3 / 234353 MGIID:1918215 Length:1303 Species:Mus musculus


Alignment Length:118 Identity:23/118 - (19%)
Similarity:44/118 - (37%) Gaps:38/118 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 ICREDYAVESIVPHPEYD-----MHNISRPNDICI----------------LRLASDVTFNDYV- 228
            :|||.:|...:|....||     :||.....|:.:                :|:::|......: 
Mouse    65 LCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVLDLRGKFKRPPLRRVRVSADAMLRALLG 129

  Fly   229 --RPICLPFDPDVQQLPIVDEIFTVTGWGETEDRRP---SDTQKHVE-LPGLE 275
              ..:.:....:::.:...|          ||..||   .|.:|:|| :.|:|
Mouse   130 SKHKVSMDLRANLKSVKKED----------TEKERPVEVGDWRKNVEAMSGME 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 23/118 (19%)
Psd3XP_036009810.1 Sec7 823..977 CDD:238100
PH_EFA6 1022..1147 CDD:270107
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.