DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and Cyth1

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_001106170.1 Gene:Cyth1 / 19157 MGIID:1334257 Length:400 Species:Mus musculus


Alignment Length:247 Identity:108/247 - (43%)
Similarity:153/247 - (61%) Gaps:11/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 VQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEAL------EERK--MRKEVMETGIEL 592
            |.|..:.|:.|....|:.........:...:|::.::...:      ||||  .|.:.:..|.:.
Mouse    10 VPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRNKQVAMGRKK 74

  Fly   593 FNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFR 657
            ||..|:||:|||.|..||..||.|||::|::.|.|:||.||:|:||.|:.|.:|:.|:::..:|.
Mouse    75 FNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFSIQVLHAFVELHEFT 139

  Fly   658 QMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDL 722
            .:.:|.|||..|..||||||||||||:||.||.|||:||  ..:|||.||.|||:|:||||.|.|
Mouse   140 DLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN--TGVFQSTDTCYVLSFAIIMLNTSL 202

  Fly   723 HSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSG 774
            |:|.||.|.|.|::|.|||||:|. .|||||.|.::|:.|.....|:..:.|
Mouse   203 HNPNVKDKPTVERFIAMNRGINDG-GDLPEELLRNLYESIKNEPFKIPEDDG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 108/247 (44%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 96/184 (52%)
DUF1981 1080..1161 CDD:286414
Cyth1NP_001106170.1 DUF342 <8..90 CDD:302792 21/79 (27%)
Sec7 64..246 CDD:279680 96/184 (52%)
PH_GRP1-like 261..381 CDD:269954
PH 265..379 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.