DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and Cyth1

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_446362.1 Gene:Cyth1 / 116691 RGDID:620397 Length:398 Species:Rattus norvegicus


Alignment Length:247 Identity:108/247 - (43%)
Similarity:153/247 - (61%) Gaps:11/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 VQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEAL------EERK--MRKEVMETGIEL 592
            |.|..:.|:.|....|:.........:...:|::.::...:      ||||  .|.:.:..|.:.
  Rat     8 VPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRNKQVAMGRKK 72

  Fly   593 FNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFR 657
            ||..|:||:|||.|..||..||.|||::|::.|.|:||.||:|:||.|:.|.:|:.|:::..:|.
  Rat    73 FNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFSIQVLHAFVELHEFT 137

  Fly   658 QMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDL 722
            .:.:|.|||..|..||||||||||||:||.||.|||:||  ..:|||.||.|||:|:||||.|.|
  Rat   138 DLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN--TGVFQSTDTCYVLSFAIIMLNTSL 200

  Fly   723 HSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSG 774
            |:|.||.|.|.|::|.|||||:|. .|||||.|.::|:.|.....|:..:.|
  Rat   201 HNPNVKDKPTVERFIAMNRGINDG-GDLPEELLRNLYESIKNEPFKIPEDDG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 108/247 (44%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 96/184 (52%)
DUF1981 1080..1161 CDD:286414
Cyth1NP_446362.1 Sec7 62..244 CDD:307500 96/184 (52%)
PH_GRP1-like 259..379 CDD:269954
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 269..277
C-terminal autoinhibitory region. /evidence=ECO:0000250 388..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.