DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and cyth3b

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_021330428.1 Gene:cyth3b / 100537448 ZFINID:ZDB-GENE-130530-529 Length:396 Species:Danio rerio


Alignment Length:208 Identity:101/208 - (48%)
Similarity:141/208 - (67%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 EQLQDLPEALEERKMRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTV 631
            |||..:.|:  :...|.:.:..|.:.||..|:||:|||.|..||..|..|||::|::.|.|:|||
Zfish    50 EQLTCVGES--KTTQRNKQIAMGRKKFNMDPKKGIQFLLENDLLQQTPEDIAQFLYKGEGLNKTV 112

  Fly   632 IGNYIGENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECN 696
            ||:|:||.|:.:.:|:.|:::..:|..:.:|.|||..|..||||||||||||:||.||||||:||
Zfish   113 IGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCN 177

  Fly   697 PKNQLFQSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDE 761
            |  .:|||.||.|||:|:||||.|.||:|.|:.|...|::|.|||||:|. .|||||.|.::|:.
Zfish   178 P--GVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKPAVERFISMNRGINDG-GDLPEELLRNLYES 239

  Fly   762 ISEHEIKMKNNSG 774
            |.....|:..:.|
Zfish   240 IKSEPFKIPEDDG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 101/208 (49%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 95/184 (52%)
DUF1981 1080..1161 CDD:286414
cyth3bXP_021330428.1 Sec7 63..245 CDD:307500 95/184 (52%)
PH_GRP1-like 260..379 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.