DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and cyth1

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:XP_004916381.1 Gene:cyth1 / 100379752 XenbaseID:XB-GENE-986107 Length:405 Species:Xenopus tropicalis


Alignment Length:255 Identity:110/255 - (43%)
Similarity:160/255 - (62%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 LYVNPNM-PVPPMQVQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERK--MRKE 584
            :||..:: |...:::::....:|:..: .||.:....|.::|    :::.| ||.|..|  .|..
 Frog     5 IYVPADLTPEERIELENIRRRKQELLE-EIQRLRDELSEAMN----EVEGL-EANEGSKTLQRNR 63

  Fly   585 VMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCA 649
            .|..|.:.||..|:||:.:|||.:||..|..||||:|::.|.|:||.||:|:||.||.:..|:.:
 Frog    64 KMGMGRKKFNMDPKKGIVYLQENELLRNTPEDIARFLYKGEGLNKTAIGDYLGERDDFNISVLHS 128

  Fly   650 YIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFS 714
            ::|..:|..:.:|.|||..|..||||||||||||:||.||.|||.|||  .:|||.||.|||:|:
 Frog   129 FVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCICNP--GVFQSTDTCYVLSFA 191

  Fly   715 IIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSG 774
            :|||.|.||:|.|:.|...|::|.|||||:|. .|||||.|.::||.|.....|:..:.|
 Frog   192 VIMLNTSLHNPNVRDKPGVERFISMNRGINDG-GDLPEELLRNLYDSIRNEPFKIPEDDG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 110/255 (43%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 95/184 (52%)
DUF1981 1080..1161 CDD:286414
cyth1XP_004916381.1 Sec7 61..243 CDD:366596 95/184 (52%)
PH_GRP1-like 258..377 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.