DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and fbxo8

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_001120293.1 Gene:fbxo8 / 100145349 XenbaseID:XB-GENE-964650 Length:316 Species:Xenopus tropicalis


Alignment Length:180 Identity:51/180 - (28%)
Similarity:95/180 - (52%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 METGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAY 650
            ::.|...||..|..|:::...:.:|..:..:||:::.....|:...:..|:    |..::|:...
 Frog   136 LDEGSLTFNANPHWGIEYFISRGILDDSAKEIAKFIFCTRTLNWKNLRLYL----DRRRDVLDEL 196

  Fly   651 IDAFDFRQMEVVAALRFLLEGFRLPGE-AQKIDRLMEKFASRYCECNP--KNQLFQSADTVYVLA 712
            :...:|....:..|||........|.| .:.::.|:.||::|:|.|||  ...|..|.|.||||.
 Frog   197 VTLHNFSNQFLPNALRDFFRHIHAPEERGEYLETLITKFSNRFCACNPALARDLGLSPDAVYVLC 261

  Fly   713 FSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEI 762
            :|:|:|:.||.||.||:||:|.::|:..|   .:..::.|:::..:||.|
 Frog   262 YSLILLSIDLASPHVKNKMSKREFIRNTR---RAAQNISEDFVGHLYDNI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 51/180 (28%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 51/180 (28%)
DUF1981 1080..1161 CDD:286414
fbxo8NP_001120293.1 F-box-like 71..109 CDD:372399
Sec7 130..309 CDD:238100 51/180 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.