DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and cyth4b

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_001108375.2 Gene:cyth4b / 100141338 ZFINID:ZDB-GENE-080219-45 Length:395 Species:Danio rerio


Alignment Length:261 Identity:96/261 - (36%)
Similarity:157/261 - (60%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 MVEWS-KDLYVNPNMPVPPMQVQSPTSTEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEER 579
            |:|.| .:|.|...|.:..:::......|.      |:.:.|    .:.:....:||...|.:.:
Zfish     1 MMECSDTELTVEEQMEIERLKIHKQILLED------IEKLKS----QIENVMADIQDFKSAEDNK 55

  Fly   580 KMRKEV-METGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHS 643
            .:.:|. ..:|.:.||..|:||::||.:..||......:|.:|:::|.|:||.||:::||.::..
Zfish    56 TLEREKRFSSGKKKFNMDPKKGIRFLVDNGLLDWKAERVAEFLYKEEGLNKTAIGDFLGEREEMH 120

  Fly   644 KEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTV 708
            .:::.|:::..:|..:.:|.|||..|..||||||||||||:||.||:|||.||  ..:|||.||.
Zfish   121 LQILKAFVELHEFSDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCNCN--ISVFQSTDTC 183

  Fly   709 YVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNS 773
            |:|:|:||||.|.||:|.||.|.|.|::|.|||||::.: |||::.|:::|:.|.....|:..:.
Zfish   184 YILSFAIIMLNTSLHNPNVKDKTTLERFISMNRGINNGE-DLPDDLLTNLYNSIRNEPFKIPEDD 247

  Fly   774 G 774
            |
Zfish   248 G 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 96/261 (37%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 82/185 (44%)
DUF1981 1080..1161 CDD:286414
cyth4bNP_001108375.2 Sec7 59..241 CDD:279680 82/184 (45%)
PH_GRP1-like 256..375 CDD:269954
PH 260..372 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.