DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16863 and AT1G18560

DIOPT Version :10

Sequence 1:NP_001036361.1 Gene:CG16863 / 34784 FlyBaseID:FBgn0028931 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001319034.1 Gene:AT1G18560 / 838437 AraportID:AT1G18560 Length:690 Species:Arabidopsis thaliana


Alignment Length:142 Identity:30/142 - (21%)
Similarity:50/142 - (35%) Gaps:40/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GDIKPGFNYSLPTLNK--ALYDYYGKN----------VAIECFFDRKTHQ-QFLNEVRICFDKQL 232
            |:|.|......|...|  .|.:|..||          :...|:.|.::.| :|:|.|...::|.|
plant    38 GEIFPKSPDGGPNERKIVKLCEYAAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKML 102

  Fly   233 QSADC--------DGIVGLERIALPNSRVGT-VISNCNAAKPIFYPD-------AVPK------- 274
              ..|        ..::.:....|.||:..| .|..|.......|..       ::.|       
plant   103 --CHCKDQMAYFATSLLNVVTELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCS 165

  Fly   275 --KQEEEEEEKE 284
              ::|.||.:|:
plant   166 LAREEGEEHQKQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16863NP_001036361.1 zf-BED 4..44 CDD:427043
AT1G18560NP_001319034.1 ZnF_BED 56..99 CDD:214746 10/42 (24%)
DUF4413 429..515 CDD:433913
Dimer_Tnp_hAT 569..649 CDD:399013
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.