DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16863 and si:dkey-5n7.2

DIOPT Version :9

Sequence 1:NP_001036361.1 Gene:CG16863 / 34784 FlyBaseID:FBgn0028931 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_005159364.1 Gene:si:dkey-5n7.2 / 796802 ZFINID:ZDB-GENE-050420-254 Length:166 Species:Danio rerio


Alignment Length:96 Identity:28/96 - (29%)
Similarity:44/96 - (45%) Gaps:21/96 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSRIWK--FYDKLDRNSAQCQLCEKVIKTSG-NTSNLMKHMKT-HPQINLFDDDVVVERGIYKRR 63
            |..||.  .||..| |.:.|:.|.  :|.:| ||:||.:|::| ||:::.....:..:.|....:
Zfish    17 RIDIWSNFTYDNKD-NKSVCKPCG--VKIAGKNTTNLKRHLQTAHPEVHTKIQKMSDDHGPGGNK 78

  Fly    64 EQD-----------DKLRFRKVVPFKEESSD 83
            ..|           |.||..|   :|.||.:
Zfish    79 ASDATSTTQQQAISDFLRSSK---YKTESKE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16863NP_001036361.1 zf-BED 4..44 CDD:280965 16/43 (37%)
si:dkey-5n7.2XP_005159364.1 zf-BED 20..59 CDD:280965 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.