DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16863 and ZK662.5

DIOPT Version :9

Sequence 1:NP_001036361.1 Gene:CG16863 / 34784 FlyBaseID:FBgn0028931 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001359620.1 Gene:ZK662.5 / 191378 WormBaseID:WBGene00014040 Length:399 Species:Caenorhabditis elegans


Alignment Length:377 Identity:68/377 - (18%)
Similarity:124/377 - (32%) Gaps:103/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 IAFFVCRDRQSLQIVQGEGFQHLVKVLCPTYRPPSAAKLEAIICRESEAQRSKLCQQLAD----- 249
            ||.|......:|:..|...||.|:|.:.|....|....|...:        .|:|..|..     
 Worm    36 IARFFASQGIALECAQESLFQELIKHISPNCMVPKTYDLAKAM--------DKICSALKPLVNYE 92

  Fly   250 --ISTLSLSCSVHTNAESRSWMELVAHFHEGRQRISRTLSVLRLPDLFTSNDLVDRMDQVCQRFD 312
              :..||.:..: |....:.:|....|:.|                     ||.:|...:..|..
 Worm    93 KIVGPLSATIDI-TGENDQKYMAFSIHYFE---------------------DLYERKSAIYLRKL 135

  Fly   313 I-----PKSRICCVSTRSSQLLEDAVTSFMGAH------------------------HHVPCFAD 348
            :     |::.:|        :|..||.|:..::                        .:..||..
 Worm   136 VFGTINPENILC--------MLRRAVNSYSFSNVRFSNLVCSNQNVYNVFATNGLVKRYNICFYS 192

  Fly   349 QLNSILEEVVQRPEIRHLRDKVRSHV--------------QSTLQLNPQLDSIHRPISVYNMLDL 399
            .:.:.:..:::..|..:...|:|:.|              :..||.|.::|........:|...:
 Worm   193 YITNFVANLLEIEEFSNGLTKLRAFVRLIRNNSDWYARYRRMQLQHNGEMDVPSIDEEGWNSTAI 257

  Fly   400 YLKQTL------------VQEPLPLSTSEVDLCQQLLDVLRPLTSSMRELSRTPYPAASTALPIA 452
            :|.|.|            :::|..:|....:....|..:|:......:||| .|..:.|..:|..
 Worm   258 FLAQCLALHDRFIKFCDRIEQPTYISDETFNHLIYLQRLLQKCMDHCQELS-APNNSISQVVPAI 321

  Fly   453 QTLINELKQEKSAEHMVAREIRLFLVQQLEEIFERMERNLHLALASLLDPRF 504
            :::.|.: :..|..:.....||........|. |..|..|...||:.|||.:
 Worm   322 KSIRNFI-ESNSIGYQFQETIREMFTAAFGET-ESGEFQLRYDLATFLDPHY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16863NP_001036361.1 zf-BED 4..44 CDD:280965
ZK662.5NP_001359620.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.