powered by:
Protein Alignment CG16863 and B0545.4
DIOPT Version :9
Sequence 1: | NP_001036361.1 |
Gene: | CG16863 / 34784 |
FlyBaseID: | FBgn0028931 |
Length: | 661 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367375.1 |
Gene: | B0545.4 / 182029 |
WormBaseID: | WBGene00015247 |
Length: | 117 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 16/75 - (21%) |
Similarity: | 32/75 - (42%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 575 EIARYFCAGMSTLRADPFQLWEELAEAHPFLHNVAQRYLHVPATAEPADRLFTAEGAAVAAQYAR 639
|:.||....:.::....:.|......::|.|...|:|::..|..:...:|||:..|..:......
Worm 2 EVTRYLSTAVESIFPRDYWLNPLSKSSYPRLSQFARRFVICPTGSSEVERLFSTAGTILTKYRKT 66
Fly 640 LIENNMENIL 649
|...|.:.:|
Worm 67 LTSENFKMLL 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16863 | NP_001036361.1 |
zf-BED |
4..44 |
CDD:280965 |
|
B0545.4 | NP_001367375.1 |
Dimer_Tnp_hAT |
2..82 |
CDD:399013 |
16/75 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1121 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D223749at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.