DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16863 and ZNF618

DIOPT Version :9

Sequence 1:NP_001036361.1 Gene:CG16863 / 34784 FlyBaseID:FBgn0028931 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_005251749.1 Gene:ZNF618 / 114991 HGNCID:29416 Length:989 Species:Homo sapiens


Alignment Length:655 Identity:130/655 - (19%)
Similarity:225/655 - (34%) Gaps:195/655 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FHSELLFKAAKDASGIIELDDQGMIKAAAEDRISTKSVGYAWVSPEA---TVSRTETVGGDDIIE 145
            |::.||......|:     |::..| |:.:.|.....|...| .|:|   :.:.|.|.|      
Human   438 FYNNLLEHMQSHAA-----DNENNI-ASNQSRSPPAVVEEKW-KPQAQRNSANNTTTSG------ 489

  Fly   146 FEPKEELDESEKSPLPQIHAVPFAGHDNLKMEEPLPSESPFHKDIAFFVCRDRQSLQIVQGEGFQ 210
            ..|...:.|.|:..:.:                          .:...:|.|..:|.:|.|:.|.
Human   490 LTPNSMIPEKERQNIAE--------------------------RLLRVMCADLGALSVVSGKEFL 528

  Fly   211 HLVKVLCPTYRPPSAAKLEAIICRESEAQRSKLCQQLADISTLSL--------------SCSVHT 261
            .|.:.|.     .|.|:..|.          .:.:.|.:.:||:|              :|::.:
Human   529 KLAQTLV-----DSGARYGAF----------SVTEILGNFNTLALKHLPRMYNQVKVKVTCALGS 578

  Fly   262 NA--------ESR-----SWMELVAHFHEGRQRISRTLSVLRLPDLFTSNDLVDR-MDQVCQRFD 312
            ||        .|:     |...|.|:..||....|..|.| :..|:..|.|||.. :..|...|.
Human   579 NACLGIGVTCHSQSVGPDSCYILTAYQAEGNHIKSYVLGV-KGADIRDSGDLVHHWVQNVLSEFV 642

  Fly   313 IPKSRI-----CCVSTRSSQLLEDAVTSFMGAHHHVPCFADQLNSILEEVVQRPEIRHLRDKVRS 372
            :.:.|.     |.|||          ::|..|...:.|.|..|||:::.|:.:            
Human   643 MSEIRTVYVTDCRVST----------SAFSKAGMCLRCSACALNSVVQSVLSK------------ 685

  Fly   373 HVQSTLQLNPQLDSIHRPISVYNML-DLYLKQTLVQE---------PLPLSTSEVD--------- 418
               .|||..    |:|..|.:.|:. ||.....|.:|         |.|...|..|         
Human   686 ---RTLQAR----SMHEVIELLNVCEDLAGSTGLAKETFGSLEETSPPPCWNSVTDSLLLVHERY 743

  Fly   419 --LCQ--------------------QLLDVLRPLTSSMRELSRTPYPAASTALPIAQTLINELKQ 461
              :|:                    .|..:|.|:..::.|||....|.....||....|......
Human   744 EQICEFYSRAKKMNLIQSLNKHLLSNLAAILTPVKQAVIELSNESQPTLQLVLPTYVRLEKLFTA 808

  Fly   462 EKSAEHMVAREIRLFLVQQLEEIFERMERNLHLA--LASLLDP--RFRNI-PFRSGALVAQYMTQ 521
            :.:....|::...||| :.|:|.|:     :|.|  :|.:|||  :.|.: |::...::.:....
Human   809 KANDAGTVSKLCHLFL-EALKENFK-----VHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCEL 867

  Fly   522 LYDMMQAHVDSGE-QAVAKHPENRDHYDIWAAFKSFSHGKQRIVNGSNGPEAD----DEIARYFC 581
            :.::.::..:..: :..||.|                  :...|......|.|    :|:..|..
Human   868 INEVKESWAEEADFEPAAKKP------------------RSAAVENPAAQEDDRLGKNEVYDYLQ 914

  Fly   582 AGMSTLRADPFQLWEELAEAHPFLHNVAQRYLHVPATAEPADRLFTAEGAAVAAQYARLIENNME 646
            ..:.....|.||.|..:.:.|..|..:|...|.|||....:..:...|.|.:..:...|...:|.
Human   915 EPLFQATPDLFQYWSCVTQKHTKLAKLAFWLLAVPAVGARSGCVNMCEQALLIKRRRLLSPEDMN 979

  Fly   647 NILFM 651
            .::|:
Human   980 KLMFL 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16863NP_001036361.1 zf-BED 4..44 CDD:280965
ZNF618XP_005251749.1 C2H2 Zn finger 149..169 CDD:275368
C2H2 Zn finger 190..210 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.