DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16863 and LOC103910645

DIOPT Version :9

Sequence 1:NP_001036361.1 Gene:CG16863 / 34784 FlyBaseID:FBgn0028931 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_021331251.1 Gene:LOC103910645 / 103910645 -ID:- Length:228 Species:Danio rerio


Alignment Length:254 Identity:61/254 - (24%)
Similarity:111/254 - (43%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 LSTSEVDLCQQLLDVLRPLTSSMRELSRTPYPAASTALP-IAQTLINELKQEKSAEHMVAREIRL 475
            ||.:|:....:...|::|:..::..|...........|| |.|..||..:.|.|:: |....|| 
Zfish     5 LSPAEIVFLTEYCTVMKPVVKALNILQAKNNTHMGWLLPVIFQLQINLCRMETSSK-MCLPLIR- 67

  Fly   476 FLVQQ-LEEIFERMERNLHLALASLLDPRFRNIPFRSGALVAQYMTQLYDMMQA-------HVDS 532
             .||. :::.|..|.::..|..|::|.|:|:|.           .|:..|:::|       |:|.
Zfish    68 -AVQDGIQKRFGGMIQDPELIAAAILLPKFKNT-----------WTEKTDVIEAGLVYIRKHLDQ 120

  Fly   533 -GEQAV---AKHPENRDHYDIWAAFKSFSHGKQRIVNGSNGPEADDEIARYFCAGMSTLRADPFQ 593
             .|.||   .:|..:.:.:        ||..|.|...|:.  |.|:.::   |.      :|.. 
Zfish   121 MAEVAVEQDGQHSSDEEDF--------FSSMKFRRSQGTG--ELDEYLS---CV------SDKM- 165

  Fly   594 LWEELAEAHPFLHNVAQRY-LHVPATAEPADRLFTAEGAAVAAQYARLIENNMENILFM 651
               :|.::.|.:..::.:. :.:||:| ..:|||:..|....|:.||:..:|.||.|.:
Zfish   166 ---DLLKSFPHIKKLSLKLNISLPASA-ACERLFSYAGLLFTAKRARMNSSNFENQLLL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16863NP_001036361.1 zf-BED 4..44 CDD:280965
LOC103910645XP_021331251.1 Dimer_Tnp_hAT 153..224 CDD:310361 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.