DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eato and abca4a

DIOPT Version :9

Sequence 1:NP_001036360.1 Gene:Eato / 34783 FlyBaseID:FBgn0028539 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_001002206.1 Gene:abca4a / 798993 ZFINID:ZDB-GENE-050517-3 Length:280 Species:Danio rerio


Alignment Length:249 Identity:54/249 - (21%)
Similarity:94/249 - (37%) Gaps:64/249 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFLRK-NLLYLQR------------NLLPLL--LICSG------------FAGVLTAYLH----- 43
            |:||| |.||.|.            .:||.:  ::|:.            ..|:::.|.:     
Zfish    40 VWLRKANPLYRQHECHFPNKAMPSSGVLPWIQGIVCNANNPCFQHTTRGESPGLVSNYNNSILAR 104

  Fly    44 -WS-VKPVLHQINQFEAKNEMVLRELYFPGNELDYIYYSP--ISPNVEDIMDLLRVDLGIIPERL 104
             || .:.:|.:..:|.....: .:||....:.:|.:..:|  |:.....:.|:|:.|..:....|
Zfish   105 FWSDAQELLFEDTEFLQLGRL-WQELMAMSSFMDTLRTNPEAIAGRGIKVEDILKDDETLTAYLL 168

  Fly   105 R--PNNNSFEMQLEMEQQCRGSCFAI---DFHR---------------VPNRGSDRKFRYSLSSN 149
            |  |...|...|| :..|.|...||.   |.|.               .|||..    .|::.:.
Zfish   169 RDVPLTESVVQQL-INSQIRPEQFAYGVPDLHLKDIACSQTLLERFLIFPNRWG----LYAVRNA 228

  Fly   150 QMRISPRKRFVNDEEIYHQIDDDDYIRSGFLSLQHILDKQYMKYQELGKDFEVV 203
            ...::|::..:.:::.|..:|.....|  .:||...|.|..|....||.:.|.|
Zfish   229 MCVLTPQRLQIIEDKFYANLDFFKLFR--LVSLLTHLVKTIMLEMALGVEDEWV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EatoNP_001036360.1 ABC2_membrane_3 <209..347 CDD:289468
CcmA 460..767 CDD:224054
ABC_subfamily_A 461..679 CDD:213230
ABC2_membrane_3 <937..1117 CDD:289468
ABC_subfamily_A 1255..1479 CDD:213230
drrA 1262..1573 CDD:130256
abca4aNP_001002206.1 rim_protein 1..>260 CDD:130324 46/227 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53524
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.