Sequence 1: | NP_001036360.1 | Gene: | Eato / 34783 | FlyBaseID: | FBgn0028539 | Length: | 1597 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002206.1 | Gene: | abca4a / 798993 | ZFINID: | ZDB-GENE-050517-3 | Length: | 280 | Species: | Danio rerio |
Alignment Length: | 249 | Identity: | 54/249 - (21%) |
---|---|---|---|
Similarity: | 94/249 - (37%) | Gaps: | 64/249 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VFLRK-NLLYLQR------------NLLPLL--LICSG------------FAGVLTAYLH----- 43
Fly 44 -WS-VKPVLHQINQFEAKNEMVLRELYFPGNELDYIYYSP--ISPNVEDIMDLLRVDLGIIPERL 104
Fly 105 R--PNNNSFEMQLEMEQQCRGSCFAI---DFHR---------------VPNRGSDRKFRYSLSSN 149
Fly 150 QMRISPRKRFVNDEEIYHQIDDDDYIRSGFLSLQHILDKQYMKYQELGKDFEVV 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Eato | NP_001036360.1 | ABC2_membrane_3 | <209..347 | CDD:289468 | |
CcmA | 460..767 | CDD:224054 | |||
ABC_subfamily_A | 461..679 | CDD:213230 | |||
ABC2_membrane_3 | <937..1117 | CDD:289468 | |||
ABC_subfamily_A | 1255..1479 | CDD:213230 | |||
drrA | 1262..1573 | CDD:130256 | |||
abca4a | NP_001002206.1 | rim_protein | 1..>260 | CDD:130324 | 46/227 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582256 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53524 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000051 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100045 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |