DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and AT4G15030

DIOPT Version :9

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001154235.1 Gene:AT4G15030 / 827162 AraportID:AT4G15030 Length:282 Species:Arabidopsis thaliana


Alignment Length:279 Identity:108/279 - (38%)
Similarity:149/279 - (53%) Gaps:55/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FPVNLNNLSAKERHNYILSNYV----------LNLPNETESRRHKRDIDVIRENHRFL-WEDDEL 60
            :..::..|:|.|||...|.:||          :.||.:|       |.|.:||.:||: .|:|:|
plant    25 YQAHIRGLNAYERHKKFLKDYVRFYGKDKPAEVKLPVKT-------DQDTLREGYRFIRSEEDDL 82

  Fly    61 DSDTLSWEQRLALRYYRKLFKEYCIADLSRYKENKIALRWRTEQEVVTGTGQFQCGSRHCGERDN 125
            |.   ||||||..|||.||||||||||:||||..|:.||||||:||:||.|||.|||:||.|::.
plant    83 DP---SWEQRLVKRYYDKLFKEYCIADMSRYKTGKMGLRWRTEKEVMTGKGQFMCGSKHCDEKEG 144

  Fly   126 LRSWEVNFRYIEKGEPLNALVKVRLCPTHTDQLNYRTKKRECKKRRRREKEERRAEKKRKRRKLD 190
            |.|:||||.|.|.||...||||:..|....::|.|       |||:..|:.|.:.:||:||::..
plant   145 LASYEVNFSYHEAGEDKQALVKLVACERCAEKLYY-------KKRKEGERSESKEKKKQKRKRSK 202

  Fly   191 VGHESSGEEEEEPVE--------------PASESHPEASKEPTDSKDATTADEQIWQQQPDISRE 241
            ...|...:|||:..|              ..|:||.|...:..|.:...|...::         |
plant   203 SHSEDDTDEEEKRKEGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKSKL---------E 258

  Fly   242 QASRE----QEFERYLEDL 256
            .|.||    :.|:.|:|.:
plant   259 SADREGKDDENFDEYMEGM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 68/114 (60%)
AT4G15030NP_001154235.1 Fra10Ac1 63..175 CDD:286768 69/121 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 142 1.000 Domainoid score I1517
eggNOG 1 0.900 - - E1_KOG1297
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13852
Inparanoid 1 1.050 176 1.000 Inparanoid score I1484
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1444601at2759
OrthoFinder 1 1.000 - - FOG0006262
OrthoInspector 1 1.000 - - oto3730
orthoMCL 1 0.900 - - OOG6_104275
Panther 1 1.100 - - LDO PTHR11567
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4544
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.