DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and Acph-1

DIOPT Version :9

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster


Alignment Length:66 Identity:15/66 - (22%)
Similarity:27/66 - (40%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLNNLSAKERHNYILSNYVLNLPNETESRRHKRDIDVIRENHRFLWEDDELDSDTLSWEQRLALR 74
            :|.||..:|  :|.|..::.|        |:...:..|..|.....:..::|...:|.:..||..
  Fly   100 DLTNLGKQE--HYDLGKWLRN--------RYSNLLPPIYSNENIYVQSTDVDRTLMSAQSNLAGL 154

  Fly    75 Y 75
            |
  Fly   155 Y 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 7/34 (21%)
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11567
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.