DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and fra10ac1

DIOPT Version :9

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001006006.2 Gene:fra10ac1 / 449836 ZFINID:ZDB-GENE-041010-95 Length:339 Species:Danio rerio


Alignment Length:269 Identity:115/269 - (42%)
Similarity:166/269 - (61%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLNNLSAKERHNYILSNYVLNLPNETESRRH-----KRDIDVIRENHRFLWEDDELDSDTLSWEQ 69
            :|.:::|.|||...:|:|:|....:.|..|.     |.|:||::|||||||:::  |.:.::||:
Zfish    80 HLISMNAFERHKKFVSDYILYYGGKIEDLRRSTSKDKTDLDVVKENHRFLWKEE--DEEDMTWEK 142

  Fly    70 RLALRYYRKLFKEYCIADLSRYKENKIALRWRTEQEVVTGTGQFQCGSRHCGERDNLRSWEVNFR 134
            .||.:||.||||||||||||||||||...|||.|.||::|.|||.||::.|..::.|:||||||.
Zfish   143 ELAKKYYDKLFKEYCIADLSRYKENKFGFRWRIENEVISGKGQFLCGNKRCESKEGLKSWEVNFA 207

  Fly   135 YIEKGEPLNALVKVRLCPTHTDQLNYRTKKRE--CKKRRRRE---------------KEERRAEK 182
            |:|:||..|||||:||||..:.:|||..|::|  .|||||.:               |.:|:.::
Zfish   208 YVEQGEKRNALVKLRLCPECSYKLNYHHKRKEVTAKKRRRSKENLDVSKKSKSSKSRKNKRKDKR 272

  Fly   183 KRKRRKLDVGHESSGEEEEEPVEPASESHPEASKEPTDSKDATTADEQIWQQQPDISREQASREQ 247
            |.|:|:.:  |.||..||       |:...:.|.:..|.:||....|....:.|..:.|:.|||:
Zfish   273 KHKKRRKE--HSSSSSEE-------SQESDKGSDDDDDDEDADGPSESEHWKGPAPAVEEKSREE 328

  Fly   248 EFERYLEDL 256
            ||:.|.||:
Zfish   329 EFDEYFEDM 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 68/113 (60%)
fra10ac1NP_001006006.2 Fra10Ac1 117..229 CDD:286768 68/113 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580356
Domainoid 1 1.000 165 1.000 Domainoid score I3876
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13852
Inparanoid 1 1.050 218 1.000 Inparanoid score I3566
OMA 1 1.010 - - QHG49260
OrthoDB 1 1.010 - - D1444601at2759
OrthoFinder 1 1.000 - - FOG0006262
OrthoInspector 1 1.000 - - oto41593
orthoMCL 1 0.900 - - OOG6_104275
Panther 1 1.100 - - LDO PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4544
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.