DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and FRA10AC1

DIOPT Version :9

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001334641.1 Gene:FRA10AC1 / 118924 HGNCID:1162 Length:315 Species:Homo sapiens


Alignment Length:260 Identity:106/260 - (40%)
Similarity:164/260 - (63%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSAKERHNYILSNYVLNLPNETE-----SRRHKRDIDVIRENHRFLW-EDDELDSDTLSWEQRLA 72
            :.|.:||...:::|:|....:.|     ....|.|:||||||||||| |:||:|   ::||:|||
Human    71 MDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMD---MTWEKRLA 132

  Fly    73 LRYYRKLFKEYCIADLSRYKENKIALRWRTEQEVVTGTGQFQCGSRHCGERDNLRSWEVNFRYIE 137
            .:||.||||||||||||:|||||...|||.|:||::|.|||.||:::|.:::.|:||||||.|||
Human   133 KKYYDKLFKEYCIADLSKYKENKFGFRWRVEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIE 197

  Fly   138 KGEPLNALVKVRLCPTHTDQLNYRTKKRECKKRRRREKEERRAEK---KRKR--------RKLDV 191
            .||..|||||:|||...:.:||:..:::|.|.::|::|.::..|:   |:.|        :|.|.
Human   198 HGEKRNALVKLRLCQECSIKLNFHHRRKEIKSKKRKDKTKKDCEESSHKKSRLSSAEEASKKKDK 262

  Fly   192 GHESSGEEEEEPVEPASESHPEASKEPTDSKDATTADEQIWQQQPDISREQASREQEFERYLEDL 256
            ||.||.:.|:..:..:.|             :.:.::.::| :.|....::.|:|:||:.|.:||
Human   263 GHSSSKKSEDSLLRNSDE-------------EESASESELW-KGPLPETDEKSQEEEFDEYFQDL 313

  Fly   257  256
            Human   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 73/114 (64%)
FRA10AC1NP_001334641.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..315 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146899
Domainoid 1 1.000 164 1.000 Domainoid score I3949
eggNOG 1 0.900 - - E1_KOG1297
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13852
Inparanoid 1 1.050 206 1.000 Inparanoid score I3716
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49260
OrthoDB 1 1.010 - - D1444601at2759
OrthoFinder 1 1.000 - - FOG0006262
OrthoInspector 1 1.000 - - oto89839
orthoMCL 1 0.900 - - OOG6_104275
Panther 1 1.100 - - LDO PTHR11567
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4544
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.