DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and SMK1

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_015379.1 Gene:SMK1 / 856167 SGDID:S000006258 Length:388 Species:Saccharomyces cerevisiae


Alignment Length:361 Identity:133/361 - (36%)
Similarity:206/361 - (57%) Gaps:26/361 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IPETYQNLQPVGQGAYGQVCKAVVRGTS--TKVAIKKLARPFQSAVHAKRTYRELRLLKHM-DHE 81
            ||..|:.:|.:|:||||.||....:|.|  .::|:||::..|...:..||..|||:.:... .|:
Yeast    34 IPGYYEIIQFLGKGAYGTVCSVKFKGRSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGHK 98

  Fly    82 NVIGLLDV-FHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQ-KLSDDHVQFLVYQILRGLKYI 144
            |::.|:|: .....|.|.|      |....|:|.||..:|.:. :||:.|:::.:||||.|||||
Yeast    99 NIVNLIDLEIVTSSPYDGL------YCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYI 157

  Fly   145 HSAGVIHRDLKPSNIAVNEDCELRILDFGLAR-----------PAESEMTGYVATRWYRAPEIML 198
            |||.||||||||.||....:..|:|.||||||           ..:..:|.|||||||||||::|
Yeast   158 HSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYVATRWYRAPELLL 222

  Fly   199 NWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIR 263
            :...|:::.|||:||||:||....:.:|.|.|.:||:..|::|||||..:.:.:..:..|.|..:
Yeast   223 SNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEIIKVLGTPDKDILIKFGTIKAWNLGK 287

  Fly   264 SL--PVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTA--A 324
            :.  ||..:..:.:||..|:..||:|:|.:|..|:..|:..|||::||::.:...|.||...  .
Yeast   288 NSNNPVYKKIPWSNIFPFASHEAINLIESLLHWDSTHRLNVEQAISHPFLNEVRKPDDEPVCLQG 352

  Fly   325 LYDQSFEENELPVEKWREMVFSEVTAFKPTAAFAEL 360
            .:|.::|.....:.|.|:.:..||..||...:.:.|
Yeast   353 PFDFTYESELNSMSKLRDYLVEEVKNFKTDLSSSSL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 131/352 (37%)
S_TKc 24..311 CDD:214567 119/304 (39%)
SMK1NP_015379.1 PKc_like 37..376 CDD:419665 126/344 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.