DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MPK2

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana


Alignment Length:360 Identity:167/360 - (46%)
Similarity:240/360 - (66%) Gaps:11/360 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKR 67
            |...|.| ..:.:|.:||...|..::|:|:||||.||.:|.|.::.:|||||:...|::.:.|.|
plant    12 RNQGKHY-FSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIHNVFENRIDALR 75

  Fly    68 TYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIR-TQKLSDDHVQ 131
            |.|||:||:|:.||||:.|.||    ..|:....|:.||:|..|||.||:.||: :|.||:||.|
plant    76 TLRELKLLRHLRHENVVALKDV----MMANHKRSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQ 136

  Fly   132 FLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESE---MTGYVATRWYRA 193
            :.::|:||||||||||.::||||||.|:.||.:|:|:|.||||||.:.::   ||.||.||||||
plant   137 YFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLARTSNTKGQFMTEYVVTRWYRA 201

  Fly   194 PEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESA 258
            ||::|...:|..:.|:||||||.||||..:.:||||:.::|:.||:.:||:..:|.:..|.:..|
plant   202 PELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECLNQIKLIINILGSQREEDLEFIDNPKA 266

  Fly   259 RNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTA 323
            :.||.|||..|..:|..::.|||.||||||:|||.||..|||:..:||.||||...:||:....|
plant   267 KRYIESLPYSPGISFSRLYPGANVLAIDLLQKMLVLDPSKRISVTEALQHPYMAPLYDPSANPPA 331

  Fly   324 AL-YDQSFEENE-LPVEKWREMVFSEVTAFKPTAA 356
            .: .|...:|:| |..|..||:::.|:..:.|.||
plant   332 QVPIDLDVDEDEDLGAEMIRELMWKEMIHYHPEAA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 162/350 (46%)
S_TKc 24..311 CDD:214567 145/290 (50%)
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 160/340 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.