DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MPK14

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_195363.1 Gene:MPK14 / 829797 AraportID:AT4G36450 Length:361 Species:Arabidopsis thaliana


Alignment Length:343 Identity:160/343 - (46%)
Similarity:228/343 - (66%) Gaps:6/343 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMD 79
            :|.:||...|..::|:|:||||.||.::...|:.:|||||:...|::.:.|.||.|||:||:|:.
plant    23 QTLFEIDTKYVPIKPIGRGAYGVVCSSINSETNERVAIKKIHNVFENRIDALRTLRELKLLRHVR 87

  Fly    80 HENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIR-TQKLSDDHVQFLVYQILRGLKY 143
            |||||.|.||..|....    .|:.||:|..|||:|||.||: :|.|||||.::.::|:||||||
plant    88 HENVISLKDVMLPTHRY----SFRDVYLVYELMDSDLNQIIKSSQSLSDDHCKYFLFQLLRGLKY 148

  Fly   144 IHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTAD 208
            :|||.::||||||.|:.||.:|:|:|.||||||..|..||.||.||||||||::|...:|..:.|
plant   149 LHSANILHRDLKPGNLLVNANCDLKICDFGLARTYEQFMTEYVVTRWYRAPELLLCCDNYGTSID 213

  Fly   209 IWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPVMPRRNF 273
            :||||||.||:|..:.:||||:.::||.||:.|:|:..|..:..|.::.||.:|:|||.....:|
plant   214 VWSVGCIFAEILGRKPIFPGTECLNQLKLIINVVGSQQDWDLQFIDNQKARRFIKSLPFSKGTHF 278

  Fly   274 RDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAALYDQSFEENE-LPV 337
            ..|:..|||||||||::||..|..|||:...||.|||||...:|....:..:...|.|.:| :..
plant   279 SHIYPHANPLAIDLLQRMLVFDPTKRISVSDALLHPYMEGLLEPECNPSENVPVSSLEIDENMEG 343

  Fly   338 EKWREMVFSEVTAFKPTA 355
            :..|||::.|:..:.|.|
plant   344 DMIREMMWEEMLHYLPRA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 158/339 (47%)
S_TKc 24..311 CDD:214567 144/287 (50%)
MPK14NP_195363.1 PKc_like 26..359 CDD:304357 157/336 (47%)
S_TKc 32..316 CDD:214567 144/287 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.