DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MPK19

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_188090.2 Gene:MPK19 / 820700 AraportID:AT3G14720 Length:598 Species:Arabidopsis thaliana


Alignment Length:352 Identity:140/352 - (39%)
Similarity:209/352 - (59%) Gaps:21/352 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDH 80
            ||:.....|:.|:.:|:|:||.||.|:...|..||||||:...|:....|.|..||::||:.:.|
plant    17 TEYGDANRYRILEVIGKGSYGVVCAAIDTQTGEKVAIKKINDVFEHVSDALRILREVKLLRLLRH 81

  Fly    81 ENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIR-TQKLSDDHVQFLVYQILRGLKYI 144
            .:::.:..:..|    .|..:|:.:|:|..||::||:.:|: ...|:.:|.||.:||:||.|||:
plant    82 PDIVEIKSIMLP----PSKREFKDIYVVFELMESDLHQVIKANDDLTREHHQFFLYQMLRALKYM 142

  Fly   145 HSAGVIHRDLKPSNIAVNEDCELRILDFGLAR------PAESEMTGYVATRWYRAPEIMLNW-MH 202
            |:|.|.||||||.||..|.:|:|::.||||||      |.....|.|||||||||||:..:: ..
plant   143 HTANVYHRDLKPKNILANANCKLKVCDFGLARVSFNDTPTTVFWTDYVATRWYRAPELCGSFCSK 207

  Fly   203 YNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPV 267
            |....||||:|||.||:|||:.||||...:|||:||.::||||..|.::.:.:|.||.|:..   
plant   208 YTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQLDLITDLLGTPKSETIAGVRNEKARKYLNE--- 269

  Fly   268 MPRRN---FRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPY---MEKYHDPTDEQTAALY 326
            |.::|   |...|..|:|||:.||:::|..|...|.||.:|||.||   :.|.......|..:..
plant   270 MRKKNLVPFSQKFPNADPLALRLLQRLLAFDPKDRPTAAEALADPYFKCLAKVEREPSCQPISKM 334

  Fly   327 DQSFEENELPVEKWREMVFSEVTAFKP 353
            :..||...|..:..||:::.|:..:.|
plant   335 EFEFERRRLTKDDIRELIYREILEYHP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 139/350 (40%)
S_TKc 24..311 CDD:214567 129/300 (43%)
MPK19NP_188090.2 STKc_TDY_MAPK 24..361 CDD:143364 137/343 (40%)
S_TKc 25..316 CDD:214567 128/297 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.