DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MPK17

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001030939.1 Gene:MPK17 / 814673 AraportID:AT2G01450 Length:486 Species:Arabidopsis thaliana


Alignment Length:356 Identity:140/356 - (39%)
Similarity:217/356 - (60%) Gaps:29/356 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDH 80
            ||:.....||..:.||:|:||.|..|....|..||||||:...|:....|.|..||::||:.:.|
plant     8 TEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIKKMTNVFEHVSDAIRILREIKLLRLLRH 72

  Fly    81 ENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDD----HVQFLVYQILRGL 141
            .:::.:..:..|  |...  :|:.:|:|..||::||::::   |::||    |.||.:||:||||
plant    73 PDIVEIKHIMLP--PCRK--EFKDIYVVFELMESDLHHVL---KVNDDLTPQHHQFFLYQLLRGL 130

  Fly   142 KYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR------PAESEMTGYVATRWYRAPEIMLN- 199
            |::|||.|.||||||.||..|.||:::|.|.||||      |:....|.|||||||||||:..: 
plant   131 KFMHSAHVFHRDLKPKNILANADCKIKICDLGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSF 195

  Fly   200 WMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRS 264
            :.:|....|:||||||.||:|||:.||||.:.:|||.|:.::||||:...:|||.:|.||.|:.:
plant   196 YSNYTPAIDMWSVGCIFAEMLTGKPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGN 260

  Fly   265 LPVMPRRN---FRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKY----HDPTDEQT 322
               |.|::   |...|...:|:|:.||::::..|...|.:||:|||.||.:..    ::|:.:..
plant   261 ---MRRKDPVPFTHKFPNIDPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPI 322

  Fly   323 AALYDQSFEENELPVEKWREMVFSEVTAFKP 353
            :.| :..||..:|..:..||:::.|:..:.|
plant   323 SKL-EFEFERRKLTRDDVRELMYREILEYHP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 139/354 (39%)
S_TKc 24..311 CDD:214567 128/300 (43%)
MPK17NP_001030939.1 STKc_TDY_MAPK 15..352 CDD:143364 137/347 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.