DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MAPK7

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006721620.1 Gene:MAPK7 / 5598 HGNCID:6880 Length:822 Species:Homo sapiens


Alignment Length:351 Identity:162/351 - (46%)
Similarity:229/351 - (65%) Gaps:22/351 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 82
            :::.:.|:.::.:|.||||.|..|..|.|..:|||||:...|....:||||.|||::|||..|:|
Human    49 FDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDN 113

  Fly    83 VIGLLDVFHPGQPADSLDQFQQV------YMVTHLMDADLNNIIR-TQKLSDDHVQFLVYQILRG 140
            :|.:.|:..|..|   ..:|:.|      |:|..||::||:.||. :|.|:.:||::.:||:|||
Human   114 IIAIKDILRPTVP---YGEFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRG 175

  Fly   141 LKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR-----PAESE--MTGYVATRWYRAPEIML 198
            |||:|||.||||||||||:.|||:|||:|.|||:||     |||.:  ||.|||||||||||:||
Human   176 LKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELML 240

  Fly   199 NWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIR 263
            :...|.|..|:||||||..|:|..|.||||.:::|||.|||.|||||:...:..:.:|..|.||:
Human   241 SLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ 305

  Fly   264 SLPVMPRR--NFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDE-QTAAL 325
            |||  ||:  .:..::.||:..|:.||.:||..:...||:|..||.||::.|||||.|| ..|..
Human   306 SLP--PRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPP 368

  Fly   326 YDQSFEENELPVEKWREMVFSEVTAF 351
            :|.:|:...|..|:.:|.:.:|:..|
Human   369 FDFAFDREALTRERIKEAIVAEIEDF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 162/351 (46%)
S_TKc 24..311 CDD:214567 147/302 (49%)
MAPK7XP_006721620.1 STKc_ERK5 49..390 CDD:270842 160/345 (46%)
S_TKc 55..353 CDD:214567 147/302 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.