DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and MAPK6

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_002739.1 Gene:MAPK6 / 5597 HGNCID:6879 Length:721 Species:Homo sapiens


Alignment Length:374 Identity:130/374 - (34%)
Similarity:205/374 - (54%) Gaps:46/374 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKK--LARPFQSAVHAKR 67
            ||:.::..:|...:::...|.:|:|:|.|..|.|..||......:|||||  |..| ||..||  
Human     1 MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDP-QSVKHA-- 62

  Fly    68 TYRELRLLKHMDHENVIGLLDVFHP--GQPAD---SLDQFQQVYMVTHLMDADLNNIIRTQKLSD 127
             .||:::::.:||:|::.:.::..|  .|..|   ||.:...||:|...|:.||.|::....|.:
Human    63 -LREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLE 126

  Fly   128 DHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVN-EDCELRILDFGLARPAESEMT--GYVA-- 187
            :|.:..:||:||||||||||.|:||||||:|:.:| ||..|:|.||||||..:...:  |:::  
Human   127 EHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEG 191

  Fly   188 --TRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFM 250
              |:|||:|.::|:..:|.:..|:|:.|||.||:|||:|||.|...:.|:.||:|.:....:|..
Human   192 LVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDR 256

  Fly   251 SRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYH 315
            ..:.| ....|||:....|.:....:..|.:..|:|.||::|......|:|||:||:||||..|.
Human   257 QELLS-VIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYS 320

  Fly   316 DPTDEQTAA---------------------------LYDQSFEENELPV 337
            .|.||..::                           .:|..|.|::.||
Human   321 FPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 128/371 (35%)
S_TKc 24..311 CDD:214567 116/300 (39%)
MAPK6NP_002739.1 STKc_MAPK4_6 14..355 CDD:143359 122/345 (35%)
SEG motif 189..191 0/1 (0%)
FRIEDE motif 332..337 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 701..721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.