DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and Srpk79D

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001246881.1 Gene:Srpk79D / 40461 FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster


Alignment Length:178 Identity:53/178 - (29%)
Similarity:76/178 - (42%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 NEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLF 226
            |.:..::|.|.|.|.......|..:.||.||:.|::|. ..||.||||||..|:..||.||..||
  Fly   847 NSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLG-APYNYTADIWSTACLAFELATGDYLF 910

  Fly   227 P---------GTDHIHQLNLIMEVLGTPADEFMSR--------ISSESARNYIRSLP-----VMP 269
            .         ..||:..   |:|:||:.....:.|        .|..|.||..:..|     |:.
  Fly   911 DPHAGESYSRDEDHLAH---IVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLV 972

  Fly   270 RRNFRDIFRGANPLAI----DLLEKMLELDADKRITAEQALAHPYMEK 313
            .:...|      |:..    |.|..|||.:...|.:|.:.|.||::|:
  Fly   973 EKYDWD------PVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLEQ 1014

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 53/178 (30%)
S_TKc 24..311 CDD:214567 52/174 (30%)
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 52/174 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.