DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and SRPK

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001369087.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:1009 Species:Drosophila melanogaster


Alignment Length:179 Identity:55/179 - (30%)
Similarity:82/179 - (45%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EDC--ELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTL 225
            ::|  .::|.|.|.|...:...|..:.||.||:.|:::. ..||.:|||||..|::.||.||..|
  Fly   597 DECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIG-AGYNTSADIWSTACMVFELATGDYL 660

  Fly   226 FP---------GTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGAN 281
            |.         ..||:..   |:|:||....|.:.. .:.:|:::.||..:   ||    ..|..
  Fly   661 FEPHSGESYTRDEDHLAH---IIELLGPIPREILLN-GTYAAKSFTRSCEL---RN----ISGLK 714

  Fly   282 P--LAIDLLEK-----------------MLELDADKRITAEQALAHPYM 311
            |  |...||||                 |||.|.:||.||.:.|.||::
  Fly   715 PWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 55/179 (31%)
S_TKc 24..311 CDD:214567 55/177 (31%)
SRPKNP_001369087.1 PKc_like 159..>318 CDD:419665
PKc_like <600..763 CDD:419665 54/174 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.