DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and CG42366

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster


Alignment Length:337 Identity:123/337 - (36%)
Similarity:175/337 - (51%) Gaps:35/337 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLD 88
            |..|..:|.|.||.|.....:.|..|||||::.|.:.|...| ...||::.||.:.|.|::.|.:
  Fly     4 YITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEA-MNLREVKSLKKLSHPNIVKLKE 67

  Fly    89 VFHPGQPADSLDQFQQVYMVTHLMDADLNNII--RTQKLSDDHVQFLVYQILRGLKYIHSAGVIH 151
            |....   |:|      |.|...|..:|..:|  |...|.:..::.:::|:|.||.::|..|..|
  Fly    68 VIREN---DTL------YFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFH 123

  Fly   152 RDLKPSNIAVNEDCELRILDFGLARPAESE--MTGYVATRWYRAPEIMLNWMHYNQTADIWSVGC 214
            |||||.|:..:....::|.||||||...|.  .|.||:||||||||::|:..:|..|.|:|::||
  Fly   124 RDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGC 188

  Fly   215 IMAELLTGRTLFPGTDHIHQLNLIMEVLGTP-ADEFMS--RISSESARNYIRSLPVMPRRNFRDI 276
            |||||.|.|.||||:..:.||..|..||||| .|::..  |::|.....|    |...:.....:
  Fly   189 IMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRY----PDCIKVPLSSV 249

  Fly   277 FRGANPLAIDLLEKMLELDADKRITAEQALAHPYME--KYHDPT---------DEQTAALYD--- 327
            ....:...:||||.||..|.|||.||:|:|.:||..  |...||         :.:.||...   
  Fly   250 VSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANVRLNSKYAASNGHPV 314

  Fly   328 QSFEENELPVEK 339
            ||...|.|||::
  Fly   315 QSVSNNVLPVQE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 123/337 (36%)
S_TKc 24..311 CDD:214567 111/293 (38%)
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 111/293 (38%)
S_TKc 4..284 CDD:214567 111/293 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.