DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and CG8565

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_573080.1 Gene:CG8565 / 32538 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster


Alignment Length:187 Identity:55/187 - (29%)
Similarity:81/187 - (43%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DLKPSNIAVNE-DCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIM 216
            |:.|.:.|.|| |..::|.|.|.|.......|..:.|:.|||.|::|. ..|.:|||||||.|::
  Fly   546 DIYPIDPANNECDVRVKIADLGNACYFHHHFTDDIQTKEYRALEVILG-AGYCETADIWSVACLL 609

  Fly   217 AELLTGRTLFP--------GTDHIHQLNLIMEVLGTPADEFMSRI------SSESARNYIRSLPV 267
            .||.||..||.        ..|.:| :..|:|..|        ||      ..:.:||:|.|...
  Fly   610 WELATGTYLFDTHSKRGKYNLDEVH-IAKIVETCG--------RIPWYLIRKGKHSRNFINSAGK 665

  Fly   268 MPRRNFRDIFRGANPLA-------------IDLLEKMLELDADKRITAEQALAHPYM 311
            :.........:.||.|.             ::.|..||:.:...||:|.:||...|:
  Fly   666 LCNIETLKPLKLANILIRWYGWRTRQSTEFVNFLMPMLQTNPLSRISASKALESHYL 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 55/187 (29%)
S_TKc 24..311 CDD:214567 54/185 (29%)
CG8565NP_573080.1 PKc_like 192..722 CDD:304357 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.