DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and Mapk13

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_062104.3 Gene:Mapk13 / 29513 RGDID:3045 Length:366 Species:Rattus norvegicus


Alignment Length:349 Identity:202/349 - (57%)
Similarity:263/349 - (75%) Gaps:5/349 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYREL 72
            |||.|||:|.||:|:||.....||.||||.||.|:.:.|..|||||||:|||||.:.|||.||||
  Rat     9 FYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYREL 73

  Fly    73 RLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQI 137
            .|||||.||||||||||:   .||.|:..||..|:|...|..||..|: ..:.|::.||:||||:
  Rat    74 LLLKHMHHENVIGLLDVY---TPATSVRNFQDFYLVMPFMQTDLQKIM-GMEFSEEKVQYLVYQM 134

  Fly   138 LRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMH 202
            |:|||||||||::||||||.|:||||||||:||||||||..::||||||.||||||||::|:|||
  Rat   135 LKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMTGYVVTRWYRAPEVILSWMH 199

  Fly   203 YNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPV 267
            ||||.|||||||||||:|||:|||.|.|::.||..|::|.|.|..||:.::..::|::||:|||.
  Rat   200 YNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLKDKAAKSYIQSLPQ 264

  Fly   268 MPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAAL-YDQSFE 331
            .|:::|..:|..|:|.|:|||:||||||.|||:||.||||||:.|.:.||.:|..|.. :|.:.|
  Rat   265 SPKKDFTQLFPRASPQAVDLLDKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQQPFDDALE 329

  Fly   332 ENELPVEKWREMVFSEVTAFKPTA 355
            ..:|.|::|::.::.|:..|.|.|
  Rat   330 REKLSVDEWKQHIYKEIANFSPIA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 200/345 (58%)
S_TKc 24..311 CDD:214567 177/286 (62%)
Mapk13NP_062104.3 STKc_p38delta 9..351 CDD:143384 200/345 (58%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X352
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.