DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38b and Mapk9

DIOPT Version :9

Sequence 1:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001157143.1 Gene:Mapk9 / 26420 MGIID:1346862 Length:423 Species:Mus musculus


Alignment Length:363 Identity:165/363 - (45%)
Similarity:236/363 - (65%) Gaps:22/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAK 66
            |:...:||.:.:..:.:.:.:.||.|:|:|.||.|.||.|........||:|||:||||:..|||
Mouse     4 SKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAK 68

  Fly    67 RTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQ 131
            |.||||.|||.::|:|:|.||:||   .|..:|::||.||:|..||||:|..:|. .:|..:.:.
Mouse    69 RAYRELVLLKCVNHKNIISLLNVF---TPQKTLEEFQDVYLVMELMDANLCQVIH-MELDHERMS 129

  Fly   132 FLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESE--MTGYVATRWYRAP 194
            :|:||:|.|:|::||||:||||||||||.|..||.|:||||||||.|.:.  ||.||.||:||||
Mouse   130 YLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAP 194

  Fly   195 EIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESAR 259
            |::|. |.|.:..|||||||||||::..:.||||.|:|.|.|.::|.||||:.|||.:: ..:.|
Mouse   195 EVILG-MGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQLGTPSAEFMKKL-QPTVR 257

  Fly   260 NYIRSLPVMPRRNFRDIF------------RGANPLAIDLLEKMLELDADKRITAEQALAHPYME 312
            ||:.:.|..|...|.::|            :.....|.|||.|||.:|.||||:.::||.|||:.
Mouse   258 NYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYIT 322

  Fly   313 KYHDPTDEQT--AALYDQSFEENELPVEKWREMVFSEV 348
            .::||.:.:.  ..:||...||.|..:|:|:|:::.||
Mouse   323 VWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 164/357 (46%)
S_TKc 24..311 CDD:214567 149/300 (50%)
Mapk9NP_001157143.1 STKc_JNK 25..360 CDD:270840 160/340 (47%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.