DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9014 and TRAF4

DIOPT Version :9

Sequence 1:	NP_001285905.1	Gene:	CG9014 / 34777	FlyBaseID:	FBgn0028847	Length:	328	Species:	Drosophila melanogaster
Sequence 2:	XP_011523806.1	Gene:	TRAF4 / 9618	HGNCID:	12034	Length:	477	Species:	Homo sapiens

Alignment Length:	144	Identity:	41/144 - (28%)
Similarity:	65/144 - (45%)	Gaps:	16/144 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI-CPVDRSGLLTS-- 63
            |||.. .:......|:||:|...:.||||.|.|.|.||..|:.:::.:... ||.|:..|..:
Human     3 GFDYK-FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKF 66

  Fly    64 -----HLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMK 123
                 .:.|...|...:|. |.|:|..|:.||.....|...:.|:..|..|   |:.|...|.||
Human    67 PHPYPQIYPDPELEVQVLG-LPIRCIHSEEGCRWSGPLRHLQGHLNTCSFN---VIPCPNRCPMK 127

  Fly   124 VPKDEMS---RHNC 134
            :.:.::.   :|:|
Human   128 LSRRDLPAHLQHDC 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9014	NP_001285905.1	zf-C3HC4	18..55	CDD:278524	14/37 (38%)
CG9014	NP_001285905.1	USP8_interact	137..319	CDD:286082
TRAF4	XP_011523806.1	RING	18..55	CDD:238093	13/36 (36%)
		zf-TRAF	109..163	CDD:280357	10/36 (28%)
		zf-TRAF	217..276	CDD:280357
		MATH_TRAF4	315..470	CDD:239750
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0297
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D918518at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.820