DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and AT5G37900

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_198606.1 Gene:AT5G37900 / 833769 AraportID:AT5G37900 Length:241 Species:Arabidopsis thaliana


Alignment Length:54 Identity:14/54 - (25%)
Similarity:22/54 - (40%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CPVDRSGLLTSHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAAC 106
            ||:...||    ..|:.:.|.|:|..:.:.|.....||.:.....:..||...|
plant    35 CPICCEGL----TCPIFQPMENILESILVTCPNDMFGCTESFLYGKKSTHEEEC 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 1/1 (100%)
USP8_interact 137..319 CDD:286082
AT5G37900NP_198606.1 Sina 50..>113 CDD:302762 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.