DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and TRAF6

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_004611.1 Gene:TRAF6 / 7189 HGNCID:12036 Length:522 Species:Homo sapiens


Alignment Length:373 Identity:74/373 - (19%)
Similarity:116/373 - (31%) Gaps:159/373 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CPICTDVLEEPVQSSECEHAFCRACIDKWMIQK-QICPVDRSGLLTSHLVPVSRLMRNMLSRLKI 81
            ||||...|.|.|| :.|.|.||:|||.|.:... ..||||...||.:.|.|.:...|.:|| |.:
Human    70 CPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILS-LMV 132

  Fly    82 KCTFSQSGCAQMLALEEFRTHVAACEH-----------------NPKVVVECSK----------- 118
            ||  ...||...:.|.....|.|.||.                 |..::.:|.:           
Human   133 KC--PNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAAS 195

  Fly   119 ----------------------------------------------------GCGMKVPKDEMSR 131
                                                                ||..|:.::.::|
Human   196 MAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLAR 260

  Fly   132 H---NCVFELRELVEKL--------AKEVSDLKQKQSDMEE------QSSSQRRE----MELFQY 175
            |   |....:|.|.:.:        :..:|:::..|..:.:      :...|.||    ||....
Human   261 HLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSM 325

  Fly   176 YIAALRSTNPMLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPM 240
            |::.|:.|   :|.:.:::......|. :|:.:..|..:|         |||             
Human   326 YVSELKRT---IRTLEDKVAEIEAQQC-NGIYIWKIGNFG---------MHL------------- 364

  Fly   241 HMLNMLVERCHEDRWPEGLMTLDDRRENQHLMSRYVTRLVPGLVIGKP 288
                    :|.|:..|                   |....||...|||
Human   365 --------KCQEEEKP-------------------VVIHSPGFYTGKP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 17/37 (46%)
USP8_interact 137..319 CDD:286082 29/170 (17%)
TRAF6NP_004611.1 Interaction with TAX1BP1. /evidence=ECO:0000269|PubMed:10920205 1..354 60/291 (21%)
RING 69..107 CDD:238093 17/37 (46%)
zf-TRAF 204..261 CDD:280357 3/56 (5%)
MATH_TRAF6 351..500 CDD:239745 15/84 (18%)
Interaction with TANK. /evidence=ECO:0000269|PubMed:25861989 355..522 14/80 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.