Sequence 1: | NP_001285905.1 | Gene: | CG9014 / 34777 | FlyBaseID: | FBgn0028847 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011508259.1 | Gene: | TRAF5 / 7188 | HGNCID: | 12035 | Length: | 631 | Species: | Homo sapiens |
Alignment Length: | 325 | Identity: | 61/325 - (18%) |
---|---|---|---|
Similarity: | 115/325 - (35%) | Gaps: | 114/325 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACI--DKWMIQKQICPVDRSGLLTSHLVPVSRL 71
Fly 72 MRNMLS------------------RLKI-------------KCTF-----SQSGCAQMLALEEFR 100
Fly 101 THVAA-----------C------------EHN--PKVVVECSKGCGMKVPKDEMSRH-------- 132
Fly 133 -NCVFE--------------------LRE----LVEK---LAKEVSD----LKQKQSDMEEQSSS 165
Fly 166 QRREMELFQYYIAALRSTNPMLRNI---GEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHL 227
Fly 228 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9014 | NP_001285905.1 | zf-C3HC4 | 18..55 | CDD:278524 | 14/38 (37%) |
USP8_interact | 137..319 | CDD:286082 | 21/125 (17%) | ||
TRAF5 | XP_011508259.1 | RING | 109..145 | CDD:214546 | 12/36 (33%) |
zf-TRAF | 202..257 | CDD:280357 | 7/54 (13%) | ||
zf-TRAF | 257..315 | CDD:280357 | 11/57 (19%) | ||
MATH | 478..624 | CDD:295307 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |