DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and TRAF5

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_011508259.1 Gene:TRAF5 / 7188 HGNCID:12035 Length:631 Species:Homo sapiens


Alignment Length:325 Identity:61/325 - (18%)
Similarity:115/325 - (35%) Gaps:114/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACI--DKWMIQKQICPVDRSGLLTSHLVPVSRL 71
            |..::|...|..|..||..|.|:. |.|.||:.||  .:.:....|||||:..:.:..:...:..
Human   100 VERLEERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCC 163

  Fly    72 MRNMLS------------------RLKI-------------KCTF-----SQSGCAQMLALEEFR 100
            .|.:|:                  |.::             :|.|     |...|.:.:..::.:
Human   164 KREVLNLYVYCSNAPGCNAKVILGRYQVPLACCYLLQDHLQQCLFQPVQCSNEKCREPVLRKDLK 228

  Fly   101 THVAA-----------C------------EHN--PKVVVECSKGCGMKVPKDEMSRH-------- 132
            .|::|           |            |.|  |:..|.|...|...:.|.|:..|        
Human   229 EHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAE 293

  Fly   133 -NCVFE--------------------LRE----LVEK---LAKEVSD----LKQKQSDMEEQSSS 165
             :|.|:                    |||    ::||   |.:::||    |:||:|.:::.:.:
Human   294 QDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAET 358

  Fly   166 QRREMELFQYYIAALRSTNPMLRNI---GEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHL 227
            .::..:.|:.:..........|.||   ...:|:.:.::       |.:|....:::...|...|
Human   359 IKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLE-------AQVHQLLQMVNQQQNKFDL 416

  Fly   228  227
            Human   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/38 (37%)
USP8_interact 137..319 CDD:286082 21/125 (17%)
TRAF5XP_011508259.1 RING 109..145 CDD:214546 12/36 (33%)
zf-TRAF 202..257 CDD:280357 7/54 (13%)
zf-TRAF 257..315 CDD:280357 11/57 (19%)
MATH 478..624 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.