Sequence 1: | NP_001285905.1 | Gene: | CG9014 / 34777 | FlyBaseID: | FBgn0028847 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003291.2 | Gene: | TRAF3 / 7187 | HGNCID: | 12033 | Length: | 568 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 60/270 - (22%) |
---|---|---|---|
Similarity: | 93/270 - (34%) | Gaps: | 97/270 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQ-ICPVDRSGLLTSHLVPVSRLMRNM 75
Fly 76 LSRLKIKCTFSQSGCAQMLAL-----------------------------EEFRTHV-------- 103
Fly 104 AACEH-----------------NPKVVVECSKGCGMK-VPKDEMS----------------RHNC 134
Fly 135 VFE--------------------LRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAA 179
Fly 180 LRSTNPMLRN 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9014 | NP_001285905.1 | zf-C3HC4 | 18..55 | CDD:278524 | 13/37 (35%) |
USP8_interact | 137..319 | CDD:286082 | 18/73 (25%) | ||
TRAF3 | NP_003291.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
zf-C3HC4 | 56..91 | CDD:278524 | 12/35 (34%) | ||
zf-TRAF | 136..192 | CDD:280357 | 6/55 (11%) | ||
zf-TRAF | 197..247 | CDD:280357 | 12/49 (24%) | ||
BBP1_C | <263..>321 | CDD:291921 | 18/52 (35%) | ||
Spc29 | <307..>366 | CDD:293687 | 4/5 (80%) | ||
MATH_TRAF3 | 378..563 | CDD:239746 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |