DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and TRAF3

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_003291.2 Gene:TRAF3 / 7187 HGNCID:12033 Length:568 Species:Homo sapiens


Alignment Length:270 Identity:60/270 - (22%)
Similarity:93/270 - (34%) Gaps:97/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQ-ICPVDRSGLLTSHLVPVSRLMRNM 75
            |:::..|..|..||..|.| :||.|.||.:|:...:.... .|...:..::...:...:...|.:
Human    47 VEDKYKCEKCHLVLCSPKQ-TECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREI 110

  Fly    76 LSRLKIKCTFSQSGCAQMLAL-----------------------------EEFRTHV-------- 103
            |: |:|.|.....|||:.|.|                             ::.|.||        
Human   111 LA-LQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYRE 174

  Fly   104 AACEH-----------------NPKVVVECSKGCGMK-VPKDEMS----------------RHNC 134
            |.|.|                 .|.|||.|...|.:: :.:.|:|                |:.|
Human   175 ATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGC 239

  Fly   135 VFE--------------------LRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAA 179
            ||:                    |:|....|.|:|| |.|.:| :|:..|.|....::..:.|..
Human   240 VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVS-LLQNES-VEKNKSIQSLHNQICSFEIEI 302

  Fly   180 LRSTNPMLRN 189
            .|. ..||||
Human   303 ERQ-KEMLRN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/37 (35%)
USP8_interact 137..319 CDD:286082 18/73 (25%)
TRAF3NP_003291.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
zf-C3HC4 56..91 CDD:278524 12/35 (34%)
zf-TRAF 136..192 CDD:280357 6/55 (11%)
zf-TRAF 197..247 CDD:280357 12/49 (24%)
BBP1_C <263..>321 CDD:291921 18/52 (35%)
Spc29 <307..>366 CDD:293687 4/5 (80%)
MATH_TRAF3 378..563 CDD:239746
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.