DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and TRAF2

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_066961.2 Gene:TRAF2 / 7186 HGNCID:12032 Length:501 Species:Homo sapiens


Alignment Length:272 Identity:49/272 - (18%)
Similarity:84/272 - (30%) Gaps:108/272 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAF---------------CRACIDKWMIQKQ 51
            ||....:...::.:.:|..|.:||..|.| ::|.|.:               |.||:.:.:.::.
Human    18 GFSKTLLGTKLEAKYLCSACRNVLRRPFQ-AQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEG 81

  Fly    52 ICPVDRSGLLTSHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFR-----------THVAA 105
            |..::.|.....:..      |..:..|...|  ...||.....|:|:.           |...|
Human    82 ISILESSSAFPDNAA------RREVESLPAVC--PSDGCTWKGTLKEYESCHEGRCPLMLTECPA 138

  Fly   106 C-------------EHN---------------------------PKVVVECSKGCG-MKVPKDEM 129
            |             ||.                           ||..:.|. ||| .|:|:::.
Human   139 CKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCD-GCGKKKIPREKF 202

  Fly   130 SRH---------NCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAALRST-- 183
            ..|         .|.|.....:|.:               |....|..|::..:.::|.|.|:  
Human   203 QDHVKTCGKCRVPCRFHAIGCLETV---------------EGEKQQEHEVQWLREHLAMLLSSVL 252

  Fly   184 --NPMLRNIGEQ 193
              .|:|   |:|
Human   253 EAKPLL---GDQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 12/51 (24%)
USP8_interact 137..319 CDD:286082 11/61 (18%)
TRAF2NP_066961.2 RAD18 28..>157 CDD:333230 25/137 (18%)
RING-HC_TRAF2 32..73 CDD:319553 10/41 (24%)
RING-HC finger (C3HC4-type) 34..72 CDD:319553 9/38 (24%)
zf-TRAF 178..235 CDD:280357 14/72 (19%)
TRAF_BIRC3_bd 267..329 CDD:318808
Important for interaction with BIRC2 and BIRC3. /evidence=ECO:0000250 283..293
MATH_TRAF2 334..497 CDD:239747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.