DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf1

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001258169.1 Gene:Traf1 / 687813 RGDID:1596290 Length:409 Species:Rattus norvegicus


Alignment Length:213 Identity:48/213 - (22%)
Similarity:78/213 - (36%) Gaps:72/213 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICP-VDRSGLL--------------- 61
            |||.|||.|.....:||.....            :.|:::.| |..:|::               
  Rat    43 DEERICPKCRADGLQPVSPGSL------------LTQEKVLPDVAEAGIVCPFAGVGCSFKGSPQ 95

  Fly    62 ----------TSHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHV---AACEHNPKVV 113
                      :|||.    |:..:|...| .......|.|.| |||:..:.:   .|.|....:.
  Rat    96 SVQEHEATSQSSHLY----LLLGVLKEWK-SSPGPNLGSAPM-ALEQNLSELQLQEAVEVTGDLE 154

  Fly   114 VECSKG--CGMKVPKDEMSRHNCVFE--LRELVEKLA----------KEV--------SDLKQKQ 156
            |:|.:.  |   ..::|::..:.:.|  |.:|.|||.          |||        :.:.|.|
  Rat   155 VDCYRAPCC---ESQEELALQHLLKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQ 216

  Fly   157 SDMEEQSSSQRREMELFQ 174
            .|.|...:.::|.:||.|
  Rat   217 LDREHVLNLEQRVVELQQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 7/37 (19%)
USP8_interact 137..319 CDD:286082 17/58 (29%)
Traf1NP_001258169.1 TRAF_BIRC3_bd 180..237 CDD:406958 16/55 (29%)
MATH_TRAF1 260..406 CDD:239748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.