DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Traf5

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_038947438.1 Gene:Traf5 / 684173 RGDID:1593883 Length:558 Species:Rattus norvegicus


Alignment Length:371 Identity:76/371 - (20%)
Similarity:127/371 - (34%) Gaps:110/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACI--DKWMIQKQICPVDRSGLLTSHLVPVSRL 71
            |..::|...|..|..||..|.|:. |.|.||:.||  .:.:....|||||:..:....:...:..
  Rat    36 VEQLEERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNSVPICPVDKEVIKPQEVFKDNCC 99

  Fly    72 MRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAAC------------------------------ 106
            .|.:|: |.:.|. :..||...:.|..|:.|:..|                              
  Rat   100 KREVLN-LHVYCK-NAPGCNARIILGRFQDHLQHCSFQAVPCPNQSCREAMLRKDVKEHLSAYCR 162

  Fly   107 ---------------------EHN--PKVVVECSKGCGMKVPKDEMSRH---------NCVF--- 136
                                 |.|  |...|.|...|...:|:..:..|         :|.|   
  Rat   163 FREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNKCVQTIPRAGVKEHLTVCPEAEQDCPFKHY 227

  Fly   137 ------ELRELVEKLAKEVSD----LKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIG 191
                  :...|.|.....:.|    :.:|...:|:|.|...:.:|..:..|..|..|   ::...
  Rat   228 GCTVKGKRGNLQEHERAALQDHMLLVLEKNFQLEQQISDLYQSLEQKESKIQQLAGT---VKKFE 289

  Fly   192 EQLDRFSLMQWGHGLPLANIHTWGSLISTPDNP--MHLMVRDVLRESGCPMHMLNMLVERCHEDR 254
            ::|.:|:.|...:|..|:|:.   :|.|..|..  :...||.:|:       ::|....|.    
  Rat   290 KELKQFTQMFGRNGSFLSNVQ---ALTSHTDKSAWLEAQVRQLLQ-------IVNQQQSRL---- 340

  Fly   255 WPEGLMTLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGE-NTH 299
               .|.:|.|..::       |.:.:..|......:|||.|| |.|
  Rat   341 ---DLRSLVDAVDS-------VKQRITQLEASDQRLVVLEGETNKH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 14/38 (37%)
USP8_interact 137..319 CDD:286082 37/170 (22%)
Traf5XP_038947438.1 mRING-HC-C3HC3D_TRAF5 43..85 CDD:319556 16/42 (38%)
zf-TRAF 128..183 CDD:280357 2/54 (4%)
zf-TRAF 185..241 CDD:424248 10/55 (18%)
Smc <230..>420 CDD:224117 37/174 (21%)
MATH 404..551 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.