DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Rnf41

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001157709.1 Gene:Rnf41 / 67588 MGIID:1914838 Length:317 Species:Mus musculus


Alignment Length:321 Identity:141/321 - (43%)
Similarity:214/321 - (66%) Gaps:4/321 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHL 65
            ||:|:....|.|||:||||||:.|||||||:..||||||.|||.:|..|:|.||||||.:..:||
Mouse     1 MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHL 65

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            .||.|:||||||:|:|.|..:..||:.::.|:...:|::.||||||..|.|.:|||:::||||:.
Mouse    66 RPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELP 130

  Fly   131 RHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIGEQLD 195
            .|||:..||.:|::....:::|::..::.:.|.:.|:|:::|.:.|:.|:||.||.|:|:.|.::
Mouse   131 NHNCIKHLRSVVQQQQSRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIE 195

  Fly   196 RFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPMHMLNMLVERCHEDRWPEGLM 260
            ...:::|.:.|..|.:..||.:|||||..:..:::..|.|||||..::|.|:|..||..||:||.
Mouse   196 YNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLA 260

  Fly   261 TLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGENTHMPENLRPILGLVMIFVDGVNEV 321
            ||:.|:.|:.....||.:.:|    ||..|||:..||.||.:::....||||||..||.|:
Mouse   261 TLETRQMNRRYYENYVAKRIP----GKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 24/36 (67%)
USP8_interact 137..319 CDD:286082 65/181 (36%)
Rnf41NP_001157709.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 28/41 (68%)
modified RING-HC finger (C3HC3D-type) 18..56 CDD:319548 25/37 (68%)
USP8_interact 137..315 CDD:370198 65/181 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.