DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and Rnf151

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_080481.1 Gene:Rnf151 / 67504 MGIID:1914754 Length:239 Species:Mus musculus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:75/170 - (44%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |:|||......|.:.:|.:|..||:.|.: ..|.|.||:.||.:|:.::..||..|..:....:|
Mouse     4 GYDLNLFASPPDCKFLCSVCHGVLKRPTR-LPCSHIFCKKCIFRWLARQNTCPCCRKEVTRRKMV 67

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGC-----------------------------AQML--ALEEFR 100
            .|::| |..:.||::||..:.:||                             .|:|  .|:|.|
Mouse    68 EVNKL-RKTIGRLQVKCKNAAAGCLDTHPLAHRKEHQDSCPFELMACPNEGCTVQVLRGVLDEHR 131

  Fly   101 THVAACEHNPKVVVECSKGCGMKVPKDEMSRHNCVFELRE 140
            .|   |:.|.:  ..|..|||..:...|...|||..|||:
Mouse   132 QH---CQQNGQ--QRCPLGCGSTLAALEGEHHNCYRELRD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 13/36 (36%)
USP8_interact 137..319 CDD:286082 3/4 (75%)
Rnf151NP_080481.1 RING 20..61 CDD:238093 15/41 (37%)
Sina 83..>134 CDD:302762 9/53 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.