DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and lnx2b

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_998105.2 Gene:lnx2b / 564464 ZFINID:ZDB-GENE-040426-2500 Length:678 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:71/157 - (45%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLVPVSRLMRNML 76
            ||:||:|.||...|.:|: .:.|.|.:|..|:..::..:..|||||..:........|.|:||:|
Zfish    40 VDDELVCHICLQPLLQPM-DTPCGHTYCFQCLSNFLHDQDFCPVDRQRIQLQQCRASSLLVRNLL 103

  Fly    77 SRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRHNCVFELREL 141
            .:|.:.|.| :|.|.  |:::.       ||..|.:...|.   ..|..::|..|          
Zfish   104 DKLAVLCPF-RSECE--LSMQR-------CELQPHLHNRCP---AFKRLREEAER---------- 145

  Fly   142 VEKLAKEVSDLKQKQS--DMEEQSSSQ 166
              |.....::||..:|  |:.:..|:|
Zfish   146 --KKRPSWNELKGSKSDGDLADAKSAQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 10/36 (28%)
USP8_interact 137..319 CDD:286082 7/32 (22%)
lnx2bNP_998105.2 RING 46..82 CDD:214546 10/36 (28%)
PDZ_signaling 210..291 CDD:238492
PDZ_signaling 325..406 CDD:238492
PDZ_signaling 451..537 CDD:238492
PDZ_signaling 587..671 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.