DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9014 and traf5

DIOPT Version :9

Sequence 1:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021325328.1 Gene:traf5 / 563887 ZFINID:ZDB-GENE-071120-3 Length:542 Species:Danio rerio


Alignment Length:363 Identity:71/363 - (19%)
Similarity:127/363 - (34%) Gaps:130/363 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQ--KQICPVDRSGLLTSHLVPVSRL 71
            |..::::.|||.|..::..|.|:. |.|.||..|:..:...  ...||:|...:....:...:..
Zfish    32 VSRLEQQFICPSCGGIVLNPHQTG-CGHIFCAQCVKAYTENGGSSKCPLDSIPIKPEEIFQDNCC 95

  Fly    72 MRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHN--------------------------- 109
            .|.:|: |::.|| :...|.|..:|...:.|:.||.|.                           
Zfish    96 KRELLN-LEVFCT-NAPECTQRFSLCNLQDHLKACPHERVRCSHSDCSDIVLRKNLLEHQRNACS 158

  Fly   110 --------------------------PKVVVECSKGCGMKVPKDEMSRH---------NCVFE-- 137
                                      |.|.|.||..|...:.:.::..|         :||::  
Zfish   159 YRLETCHYCRQNFPVSQMMGHQKSSCPDVEVPCSNNCTQMIKRHQLQAHADECLEVETDCVYKNY 223

  Fly   138 ----------------------LRELVE---KLAKEVSDLKQ----KQSDMEEQS---SSQRREM 170
                                  :|.::|   ||.|::..|:|    :|..::::|   ||..|::
Zfish   224 GCTVRDKRGKVQVHENTEFSAHVRLVLESNTKLEKQMEQLQQDMLVQQGVLKDKSLVVSSLDRDV 288

  Fly   171 ELFQYYIAALRSTNPMLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLI---------STPDNPMH 226
            .|....:..|:      |::.||..|...:|    ..|.::...||.:         |.......
Zfish   289 SLCDNTLTTLQ------RSVEEQRVRICSVQ----RELRDLRVLGSELKEELPRLQASLDSLRQQ 343

  Fly   227 LMVRDVLR------ESGCPMH--MLNMLVE--RCHEDR 254
            :.|.:.||      |..|..|  :|::.||  :|:|.|
Zfish   344 VAVTESLREHLGALEQTCERHTRLLDIHVEQLQCNEQR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 11/38 (29%)
USP8_interact 137..319 CDD:286082 35/171 (20%)
traf5XP_021325328.1 RING_Ubox 39..80 CDD:327409 13/41 (32%)
zf-TRAF 124..179 CDD:280357 4/54 (7%)
zf-TRAF 179..237 CDD:280357 9/57 (16%)
SMC_N <238..>387 CDD:330553 35/154 (23%)
MATH_TRAF_C 392..535 CDD:238168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.